PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00030.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 311aa    MW: 35887.6 Da    PI: 4.6685
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00030.1_g00022.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-172168148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+eEd +l+++++  G g+W++ +r+ g+ Rt+k+c++rw++yl
  Rsa1.0_00030.1_g00022.1 21 RGPWTAEEDCKLINYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
                             89********************************************97 PP

2Myb_DNA-binding50.64.6e-1674117146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Rsa1.0_00030.1_g00022.1  74 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0791668IPR017930Myb domain
SuperFamilySSF466891.54E-3018115IPR009057Homeodomain-like
SMARTSM007173.1E-142070IPR001005SANT/Myb domain
PfamPF002496.5E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-222275IPR009057Homeodomain-like
CDDcd001671.40E-112368No hitNo description
PROSITE profilePS5129422.91769123IPR017930Myb domain
SMARTSM007172.9E-1473121IPR001005SANT/Myb domain
PfamPF002497.6E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2276122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDERGRSLKN NNMEDDTDLK RGPWTAEEDC KLINYIATNG EGRWNSLSRC AGLQRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KHAKQLKCDV NSQQFKDTMK YLWMPRLVER IQSASAAALT TGSAATSSCI TTSNNQFMTY  180
DYNMGQQSGV MNNNDYITPE NSSVALSPVS DLTEYYSAPN PNPEYYSGQV GNSYYPDQNL  240
VGPQMLPENY FDYSRLLDED VPAMQEQSNL NWFENINGAA SSSDSLWDIG ESDEDFWFLQ  300
QQQQFNNNGN F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25181214106B-MYB
1h8a_C3e-251811524120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382870.0KF738287.1 Brassica napus MYB transcription factor 108-2 (MYB108-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646372.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE10.0MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3AFA80.0A0A0D3AFA8_BRAOL; Uncharacterized protein
STRINGBra040274.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-173myb domain protein 108